SCOPe 2.06: Domain d3c3ed1: 3c3e D:1-303

Lineage for d3c3ed1 (3c3e D:1-303)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.143: CofD-like [142337] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567; topological similarity to the CobT-like fold (52732)

4. Superfamily c.143.1: CofD-like [142338] (2 families)

5. Family c.143.1.1: CofD-like [142339] (3 proteins)
   Pfam PF01933; UPF0052

6. Protein LPPG:FO 2-phospho-L-lactate transferase CofD [142340] (1 species)

7. Species Methanosarcina mazei [TaxId:2209] [142341] (3 PDB entries)
   Uniprot Q8PVT6 1-309

8. Domain d3c3ed1: 3c3e D:1-303 [245453]
   Other proteins in same PDB: d3c3ea2, d3c3eb2, d3c3ec2, d3c3ed2
   automated match to d3c3da_
   complexed with fo1, gdp

Details for d3c3ed1

PDB Entry: 3c3e, 3 Å

PDB Description: Crystal structure of 2-phospho-(S)-lactate transferase from Methanosarcina mazei in complex with Fo and GDP. Northeast Structural Genomics Consortium target MaR46

PDB Compounds: (D:) 2-phospho-L-lactate transferase

SCOPe Domain Sequences for d3c3ed1:

Sequence; same for both SEQRES and ATOM records:

>d3c3ed1 c.143.1.1 (D:1-303) LPPG:FO 2-phospho-L-lactate transferase CofD {Methanosarcina mazei [TaxId: 2209]}
miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidr
krwwgiendtfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslf
gikanilpmsddpvstyietaegimhfqdfwigkrgepdvrgvdirgvseasispkvlea
fekeeniligpsnpitsigpiislpgmrellkkkkvvavspiignapvsgpagklmpacg
ievssmgvaeyyqdfldvfvfderdradefaferlgchasradtlmtstekskelaeivv
qaf

Timeline for d3c3ed1:

• d3c3ed1 first appeared in SCOPe 2.04, called d3c3ed_
  
• d3c3ed1 was called d3c3ed_ in SCOPe 2.05
  
• d3c3ed1 appears in SCOPe 2.07
  
• d3c3ed1 appears in the current release, SCOPe 2.08