SCOPe 2.08: Domain d3c20a3: 3c20 A:404-470

Lineage for d3c20a3 (3c20 A:404-470)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.0: automated matches [227175] (1 protein)
   not a true family

6. Protein automated matches [226892] (5 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:2190] [255768] (3 PDB entries)

8. Domain d3c20a3: 3c20 A:404-470 [245442]
   Other proteins in same PDB: d3c20a1, d3c20b1
   automated match to d2hmfa2
   complexed with asp, fmt

Details for d3c20a3

PDB Entry: 3c20, 2.7 Å

PDB Description: Crystal Structure of Threonine-sensitive Aspartokinase from Methanococcus jannaschii with L-aspartate

PDB Compounds: (A:) Probable aspartokinase

SCOPe Domain Sequences for d3c20a3:

Sequence; same for both SEQRES and ATOM records:

>d3c20a3 d.58.18.0 (A:404-470) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfiek

Timeline for d3c20a3:

• d3c20a3 first appeared in SCOPe 2.04
  
• d3c20a3 appears in SCOPe 2.07