Lineage for d1sema_ (1sem A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13145Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 13146Species Caenorhabditis elegans, SEM-5 [TaxId:6239] [50073] (3 PDB entries)
  8. 13147Domain d1sema_: 1sem A: [24544]

Details for d1sema_

PDB Entry: 1sem (more details), 2 Å

PDB Description: structural determinants of peptide-binding orientation and of sequence specificity in sh3 domains

SCOP Domain Sequences for d1sema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5}
etkfvqalfdfnpqesgelafkrgdvitlinkddpnwwegqlnnrrgifpsnyvcpyn

SCOP Domain Coordinates for d1sema_:

Click to download the PDB-style file with coordinates for d1sema_.
(The format of our PDB-style files is described here.)

Timeline for d1sema_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1semb_