Lineage for d3c1nd1 (3c1n D:3-300)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872996Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1872997Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1873059Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 1873102Protein automated matches [190400] (4 species)
    not a true protein
  7. 1873116Species Methanocaldococcus jannaschii [TaxId:2190] [255767] (3 PDB entries)
  8. 1873126Domain d3c1nd1: 3c1n D:3-300 [245433]
    Other proteins in same PDB: d3c1na2, d3c1na3, d3c1nb2, d3c1nb3, d3c1nc2, d3c1nc3, d3c1nd2, d3c1nd3
    automated match to d2hmfa1
    complexed with thr

Details for d3c1nd1

PDB Entry: 3c1n (more details), 2.72 Å

PDB Description: crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
PDB Compounds: (D:) Probable aspartokinase

SCOPe Domain Sequences for d3c1nd1:

Sequence, based on SEQRES records: (download)

>d3c1nd1 c.73.1.3 (D:3-300) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
tvmkfggtsvgsgerirhvakivtkrkkedddvvvvvsamsevtnalveisqqaldvrdi
akvgdfikfirekhykaieeaikseeikeevkkiidsrieelekvligvaylgeltpksr
dyilsfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpll
kegiipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdprl
vptarripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn

Sequence, based on observed residues (ATOM records): (download)

>d3c1nd1 c.73.1.3 (D:3-300) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
tvmkfggtsvgsgerirhvakivtkrkkedvvvvsamsevtnalveisqqaldvrdiakv
gdfikfirekhykaieeaiseeikeevkkiidsrieelekvligvaylgeltpksrdyil
sfgerlsspilsgairdlgeksialeggeagiitdnnfgsarvkrlevkerllpllkegi
ipvvtgfigtteegyittlgrggsdysaaligygldadiieiwtdvsgvyttdprlvpta
rripklsyieamelayfgakvlhprtiepamekgipilvkntfepesegtlitn

SCOPe Domain Coordinates for d3c1nd1:

Click to download the PDB-style file with coordinates for d3c1nd1.
(The format of our PDB-style files is described here.)

Timeline for d3c1nd1: