| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
| Family d.58.18.0: automated matches [227175] (1 protein) not a true family |
| Protein automated matches [226892] (5 species) not a true protein |
| Species Methanocaldococcus jannaschii [TaxId:2190] [255768] (3 PDB entries) |
| Domain d3c1nc3: 3c1n C:404-469 [245432] Other proteins in same PDB: d3c1na1, d3c1nb1, d3c1nc1, d3c1nd1 automated match to d2hmfa2 complexed with thr |
PDB Entry: 3c1n (more details), 2.72 Å
SCOPe Domain Sequences for d3c1nc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1nc3 d.58.18.0 (C:404-469) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfie
Timeline for d3c1nc3: