Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (38 proteins) |
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries) |
Domain d1gbra_: 1gbr A: [24543] N-terminal domain |
PDB Entry: 1gbr (more details)
SCOP Domain Sequences for d1gbra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gbra_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]} gsrrasvgsmeaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipkn yiemkphpefivtd
Timeline for d1gbra_: