Lineage for d1gbra_ (1gbr A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665245Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 665266Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)
  8. 665271Domain d1gbra_: 1gbr A: [24543]
    N-terminal domain

Details for d1gbra_

PDB Entry: 1gbr (more details)

PDB Description: orientation of peptide fragments from sos proteins bound to the n- terminal sh3 domain of grb2 determined by nmr spectroscopy
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d1gbra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbra_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
gsrrasvgsmeaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipkn
yiemkphpefivtd

SCOP Domain Coordinates for d1gbra_:

Click to download the PDB-style file with coordinates for d1gbra_.
(The format of our PDB-style files is described here.)

Timeline for d1gbra_: