Lineage for d1gbra1 (1gbr A:1-61)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783045Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2783066Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)
  8. 2783071Domain d1gbra1: 1gbr A:1-61 [24543]
    Other proteins in same PDB: d1gbra2, d1gbra3
    N-terminal domain

Details for d1gbra1

PDB Entry: 1gbr (more details)

PDB Description: orientation of peptide fragments from sos proteins bound to the n- terminal sh3 domain of grb2 determined by nmr spectroscopy
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gbra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gbra1 b.34.2.1 (A:1-61) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkphpe
f

SCOPe Domain Coordinates for d1gbra1:

Click to download the PDB-style file with coordinates for d1gbra1.
(The format of our PDB-style files is described here.)

Timeline for d1gbra1: