SCOPe 2.08: Domain d1gbra1: 1gbr A:1-61

Lineage for d1gbra1 (1gbr A:1-61)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)

8. Domain d1gbra1: 1gbr A:1-61 [24543]
   Other proteins in same PDB: d1gbra2, d1gbra3
   N-terminal domain

Details for d1gbra1

PDB Entry: 1gbr

PDB Description: orientation of peptide fragments from sos proteins bound to the n- terminal sh3 domain of grb2 determined by nmr spectroscopy

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gbra1:

Sequence; same for both SEQRES and ATOM records:

>d1gbra1 b.34.2.1 (A:1-61) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkphpe
f

Timeline for d1gbra1:

• d1gbra1 first appeared (with stable ids) in SCOP 1.55, called d1gbra_
  
• d1gbra1 appears in SCOPe 2.07