Lineage for d3c1nb3 (3c1n B:404-469)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954274Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 2954275Protein automated matches [226892] (5 species)
    not a true protein
  7. 2954322Species Methanocaldococcus jannaschii [TaxId:2190] [255768] (3 PDB entries)
  8. 2954338Domain d3c1nb3: 3c1n B:404-469 [245429]
    Other proteins in same PDB: d3c1na1, d3c1nb1, d3c1nc1, d3c1nd1
    automated match to d2hmfa2
    complexed with thr

Details for d3c1nb3

PDB Entry: 3c1n (more details), 2.72 Å

PDB Description: crystal structure of allosteric inhibition threonine-sensitive aspartokinase from methanococcus jannaschii with l-threonine
PDB Compounds: (B:) Probable aspartokinase

SCOPe Domain Sequences for d3c1nb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1nb3 d.58.18.0 (B:404-469) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfie

SCOPe Domain Coordinates for d3c1nb3:

Click to download the PDB-style file with coordinates for d3c1nb3.
(The format of our PDB-style files is described here.)

Timeline for d3c1nb3: