| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries) |
| Domain d3gbqa_: 3gbq A: [24542] N-terminal domain |
PDB Entry: 3gbq (more details)
SCOPe Domain Sequences for d3gbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gbqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp
Timeline for d3gbqa_: