Lineage for d3gbqa_ (3gbq A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392660Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2392681Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)
  8. 2392684Domain d3gbqa_: 3gbq A: [24542]
    N-terminal domain

Details for d3gbqa_

PDB Entry: 3gbq (more details)

PDB Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, minimized average structure
PDB Compounds: (A:) grb2

SCOPe Domain Sequences for d3gbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp

SCOPe Domain Coordinates for d3gbqa_:

Click to download the PDB-style file with coordinates for d3gbqa_.
(The format of our PDB-style files is described here.)

Timeline for d3gbqa_: