Lineage for d3c1mb2 (3c1m B:304-403)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653844Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1654045Family d.58.18.0: automated matches [227175] (1 protein)
    not a true family
  6. 1654046Protein automated matches [226892] (5 species)
    not a true protein
  7. 1654093Species Methanocaldococcus jannaschii [TaxId:2190] [255768] (3 PDB entries)
  8. 1654096Domain d3c1mb2: 3c1m B:304-403 [245416]
    Other proteins in same PDB: d3c1ma1, d3c1mb1, d3c1mc1, d3c1md1
    automated match to d2hmfa3
    complexed with anp, asp, fmt, mg

Details for d3c1mb2

PDB Entry: 3c1m (more details), 2.3 Å

PDB Description: cyrstal structure of threonine-sensitive aspartokinase from methanococcus jannaschii with mgamp-pnp and l-aspartate
PDB Compounds: (B:) Probable aspartokinase

SCOPe Domain Sequences for d3c1mb2:

Sequence, based on SEQRES records: (download)

>d3c1mb2 d.58.18.0 (B:304-403) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
msdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnisl
vvseedvdkalkalkrefgdfgkksflnnnlirdvsvdkd

Sequence, based on observed residues (ATOM records): (download)

>d3c1mb2 d.58.18.0 (B:304-403) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
msdsivkaistiknvalinifgagmvgvsgtaarifkalgeeevnvilisqgssetnisl
vvseedvdkalkalkrefgdsflnnnlirdvsvdkd

SCOPe Domain Coordinates for d3c1mb2:

Click to download the PDB-style file with coordinates for d3c1mb2.
(The format of our PDB-style files is described here.)

Timeline for d3c1mb2: