Lineage for d3bxxe_ (3bxx E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846993Species Grape (Vitis vinifera) [TaxId:29760] [255079] (11 PDB entries)
  8. 2847015Domain d3bxxe_: 3bxx E: [245402]
    automated match to d2p4hx_
    complexed with nap, que

Details for d3bxxe_

PDB Entry: 3bxx (more details), 2.9 Å

PDB Description: Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site
PDB Compounds: (E:) dihydroflavonol 4-reductase

SCOPe Domain Sequences for d3bxxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bxxe_ c.2.1.0 (E:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
etvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkadl
adegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlvf
tssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennidf
itiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfenp
kaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfefk
ysledmftgavdtcrakgllppsh

SCOPe Domain Coordinates for d3bxxe_:

Click to download the PDB-style file with coordinates for d3bxxe_.
(The format of our PDB-style files is described here.)

Timeline for d3bxxe_: