Lineage for d2gbqa_ (2gbq A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13145Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 13162Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)
  8. 13164Domain d2gbqa_: 2gbq A: [24540]

Details for d2gbqa_

PDB Entry: 2gbq (more details)

PDB Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures

SCOP Domain Sequences for d2gbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus)}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp

SCOP Domain Coordinates for d2gbqa_:

Click to download the PDB-style file with coordinates for d2gbqa_.
(The format of our PDB-style files is described here.)

Timeline for d2gbqa_: