SCOPe 2.05: Domain d3bxxa_: 3bxx A:

Lineage for d3bxxa_ (3bxx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Grape (Vitis vinifera) [TaxId:29760] [255079] (11 PDB entries)

8. Domain d3bxxa_: 3bxx A: [245398]
   automated match to d2p4hx_
   complexed with nap, que

Details for d3bxxa_

PDB Entry: 3bxx, 2.9 Å

PDB Description: Binding of two substrate analogue molecules to dihydroflavonol 4-reductase alters the functional geometry of the catalytic site

PDB Compounds: (A:) dihydroflavonol 4-reductase

SCOPe Domain Sequences for d3bxxa_:

Sequence; same for both SEQRES and ATOM records:

>d3bxxa_ c.2.1.0 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
etvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkadl
adegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlvf
tssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennidf
itiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfenp
kaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfefk
ysledmftgavdtcrakgllppsh

Timeline for d3bxxa_:

• d3bxxa_ first appeared in SCOPe 2.04
  
• d3bxxa_ appears in SCOPe 2.06
  
• d3bxxa_ appears in the current release, SCOPe 2.08