Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (6 PDB entries) |
Domain d3bx3b_: 3bx3 B: [245397] automated match to d3q0mb_ protein/RNA complex; complexed with so4; mutant |
PDB Entry: 3bx3 (more details), 3 Å
SCOPe Domain Sequences for d3bx3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx3b_ a.118.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dilgskaadaifeetkdytvelmtdsfgnyliqklleevtteqrivltkissphfveisl nphgcralqklieciktdeeaqivvdslrpytvqlskdlngnhviqkclqrlkpenfqfi fdaisdscidiathrhgcrvlqrcldhgtteqcdnlcdkllalvdkltldpfgnyvvqyi itkeaeknkydythkivhllkpraielsihkfgsnviekilktaivsepmileilnngge tgiqsllndsygnyvlqtaldishkqndylykrlseivapllvgpirntphgkriigmlh
Timeline for d3bx3b_: