![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186980] (5 PDB entries) |
![]() | Domain d3bx3a_: 3bx3 A: [245396] automated match to d3q0mb_ protein/RNA complex; complexed with so4; mutant |
PDB Entry: 3bx3 (more details), 3 Å
SCOPe Domain Sequences for d3bx3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bx3a_ a.118.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqyigsihslckdqhgcrflqkqldilgskaadaifeetkdytvelmtdsfgnyliqkll eevtteqrivltkissphfveislnphgcralqklieciktdeeaqivvdslrpytvqls kdlngnhviqkclqrlkpenfqfifdaisdscidiathrhgcrvlqrcldhgtteqcdnl cdkllalvdkltldpfgnyvvqyiitkeaeknkydythkivhllkpraielsihkfgsnv iekilktaivsepmileilnnggetgiqsllndsygnyvlqtaldishkqndylykrlse ivapllvgpirntphgkriigmlhl
Timeline for d3bx3a_: