SCOPe 2.08: Domain d3brgc2: 3brg C:360-474

Lineage for d3brgc2 (3brg C:360-474)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)

8. Domain d3brgc2: 3brg C:360-474 [245393]
   Other proteins in same PDB: d3brgc1
   automated match to d3brfa1
   protein/DNA complex; complexed with edo

Details for d3brgc2

PDB Entry: 3brg, 2.2 Å

PDB Description: csl (rbp-jk) bound to dna

PDB Compounds: (C:) Recombining binding protein suppressor of hairless

SCOPe Domain Sequences for d3brgc2:

Sequence; same for both SEQRES and ATOM records:

>d3brgc2 b.1.18.0 (C:360-474) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpnlrvwfgdveaet
myrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgviystsltftytpep

Timeline for d3brgc2:

• d3brgc2 first appeared in SCOPe 2.04
  
• d3brgc2 appears in SCOPe 2.07