Lineage for d3brgc2 (3brg C:360-474)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766417Species Mouse (Mus musculus) [TaxId:10090] [226768] (5 PDB entries)
  8. 2766418Domain d3brgc2: 3brg C:360-474 [245393]
    Other proteins in same PDB: d3brgc1
    automated match to d3brfa1
    protein/DNA complex; complexed with edo

Details for d3brgc2

PDB Entry: 3brg (more details), 2.2 Å

PDB Description: csl (rbp-jk) bound to dna
PDB Compounds: (C:) Recombining binding protein suppressor of hairless

SCOPe Domain Sequences for d3brgc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brgc2 b.1.18.0 (C:360-474) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpnlrvwfgdveaet
myrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgviystsltftytpep

SCOPe Domain Coordinates for d3brgc2:

Click to download the PDB-style file with coordinates for d3brgc2.
(The format of our PDB-style files is described here.)

Timeline for d3brgc2: