Lineage for d3bopc1 (3bop C:87-260)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050810Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2050892Protein automated matches [190380] (2 species)
    not a true protein
  7. 2050893Species Mouse (Mus musculus) [TaxId:10090] [188387] (8 PDB entries)
  8. 2050914Domain d3bopc1: 3bop C:87-260 [245388]
    Other proteins in same PDB: d3bopa2, d3bopc2
    automated match to d3mw3a_

Details for d3bopc1

PDB Entry: 3bop (more details), 3 Å

PDB Description: Structure of mouse beta-neurexin 2D4
PDB Compounds: (C:) beta-Neurexin 2D4

SCOPe Domain Sequences for d3bopc1:

Sequence, based on SEQRES records: (download)

>d3bopc1 b.29.1.4 (C:87-260) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvdsasglgdylqlhid
qgtvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvnerypagrql
tifnsqaaikiggrdqgrpfqgqvsglyynglkvlalaaesdpnvrteghlrlv

Sequence, based on observed residues (ATOM records): (download)

>d3bopc1 b.29.1.4 (C:87-260) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvdsasglgdylqlhid
qgtvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvnerypagnsq
aaikiggrdqgrpfqgqvsglyynglkvlalaaesdpnvrteghlrlv

SCOPe Domain Coordinates for d3bopc1:

Click to download the PDB-style file with coordinates for d3bopc1.
(The format of our PDB-style files is described here.)

Timeline for d3bopc1: