Lineage for d3bila_ (3bil A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144102Species Corynebacterium glutamicum [TaxId:196627] [255762] (1 PDB entry)
  8. 2144103Domain d3bila_: 3bil A: [245376]
    automated match to d3k4ha_

Details for d3bila_

PDB Entry: 3bil (more details), 2.5 Å

PDB Description: crystal structure of a probable laci family transcriptional regulator from corynebacterium glutamicum
PDB Compounds: (A:) Probable LacI-family transcriptional regulator

SCOPe Domain Sequences for d3bila_:

Sequence, based on SEQRES records: (download)

>d3bila_ c.93.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tigvivpslinhyfaamvteiqstaskaglatiitnsnedattmsgslefltshgvdgii
cvpneecanqledlqkqgmpvvlvdrelpgdstiptatsnpqpgiaaavellahnnalpi
gylsgpmdtstgrerledfkaacanskigeqlvflggyeqsvgfegatklldqgaktlfa
gdsmmtigvieachkaglvigkdvsvigfdthplfalqphpltvidqnveqlaqravsil
teliagtvpsvtkttiptalihresiins

Sequence, based on observed residues (ATOM records): (download)

>d3bila_ c.93.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
tigvivpslinhyfaamvteiqstaskaglatiitnsnedattmsgslefltshgvdgii
cvpneecanqledlqkqmpvvlvdrelpgdtiptatsnpqpgiaaavellahnnalpigy
lsgpmdtstgrerledfkaacanskigeqlvflggyeqsvgfegatklldqgaktlfagd
smmtigvieachkaglvigkdvsvigfdthplfalqphpltvidqnveqlaqravsilte
lttiptalihresiins

SCOPe Domain Coordinates for d3bila_:

Click to download the PDB-style file with coordinates for d3bila_.
(The format of our PDB-style files is described here.)

Timeline for d3bila_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3bilb_