![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (9 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
![]() | Domain d3bgfl2: 3bgf L:108-212 [245374] Other proteins in same PDB: d3bgfa_, d3bgfc1, d3bgfl1, d3bgfs_ automated match to d2fd6l2 |
PDB Entry: 3bgf (more details), 3 Å
SCOPe Domain Sequences for d3bgfl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bgfl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d3bgfl2:
![]() Domains from other chains: (mouse over for more information) d3bgfa_, d3bgfc1, d3bgfc2, d3bgfs_ |