SCOPe 2.08: Domain d3bgfc2: 3bgf C:108-211

Lineage for d3bgfc2 (3bgf C:108-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3bgfc2: 3bgf C:108-211 [245372]
   Other proteins in same PDB: d3bgfa_, d3bgfb_, d3bgfc1, d3bgfh_, d3bgfl1, d3bgfs_
   automated match to d2fd6l2

Details for d3bgfc2

PDB Entry: 3bgf, 3 Å

PDB Description: x-ray crystal structure of the sars coronavirus spike receptor binding domain in complex with f26g19 fab

PDB Compounds: (C:) F26G19 Fab

SCOPe Domain Sequences for d3bgfc2:

Sequence, based on SEQRES records:

>d3bgfc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records):

>d3bgfc2 b.1.1.2 (C:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyehnsytceathktstspivksfnr

Timeline for d3bgfc2:

• d3bgfc2 first appeared in SCOPe 2.04
  
• d3bgfc2 appears in SCOPe 2.07