SCOPe 2.08: Domain d1gfca1: 1gfc A:3-59

Lineage for d1gfca1 (1gfc A:3-59)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gfca1: 1gfc A:3-59 [24537]
   Other proteins in same PDB: d1gfca2
   C-terminal domain

Details for d1gfca1

PDB Entry: 1gfc

PDB Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1gfca1:

Sequence; same for both SEQRES and ATOM records:

>d1gfca1 b.34.2.1 (A:3-59) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

Timeline for d1gfca1:

• d1gfca1 first appeared (with stable ids) in SCOP 1.55, called d1gfc__
  
• d1gfca1 appears in SCOPe 2.07