SCOPe 2.04: Domain d3bera_: 3ber A:

Lineage for d3bera_ (3ber A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)

8. Domain d3bera_: 3ber A: [245369]
   automated match to d2g9nb_
   protein/RNA complex; complexed with amp, pge, po4

Details for d3bera_

PDB Entry: 3ber, 1.4 Å

PDB Description: Human DEAD-box RNA-helicase DDX47, conserved domain I in complex with AMP

PDB Compounds: (A:) Probable ATP-dependent RNA helicase DDX47

SCOPe Domain Sequences for d3bera_:

Sequence; same for both SEQRES and ATOM records:

>d3bera_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teasqpiveeeetktfkdlgvtdvlceacdqlgwtkptkiqieaiplalqgrdiiglaet
gsgktgafalpilnalletpqrlfalvltptrelafqiseqfealgssigvqsavivggi
dsmsqslalakkphiiiatpgrlidhlentkgfnlralkylvmdeadrilnmdfetevdk
ilkviprdrktflfsatmtkkvqklqraalknpvkcavss

Timeline for d3bera_:

• d3bera_ is new in SCOPe 2.04-stable
  
• d3bera_ appears in SCOPe 2.05
  
• d3bera_ appears in the current release, SCOPe 2.08