Lineage for d3be8b1 (3be8 B:44-597)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (71 PDB entries)
  8. 2136274Domain d3be8b1: 3be8 B:44-597 [245368]
    Other proteins in same PDB: d3be8a2, d3be8b2
    automated match to d3b3qa_
    complexed with cl, flc, gol, na, nag, po4

Details for d3be8b1

PDB Entry: 3be8 (more details), 2.2 Å

PDB Description: Crystal structure of the synaptic protein neuroligin 4
PDB Compounds: (B:) neuroligin-4, x-linked

SCOPe Domain Sequences for d3be8b1:

Sequence, based on SEQRES records: (download)

>d3be8b1 c.69.1.0 (B:44-597) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgirnt
tqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvpteddihdqn
skkpvmvyihggsymegtgnmidgsilasygnvivitinyrlgilgflstgdqaakgnyg
lldqiqalrwieenvgafggdpkrvtifgsgagascvslltlshyseglfqkaiiqsgta
lsswavnyqpakytriladkvgcnmldttdmveclrnknykeliqqtitpatyhiafgpv
idgdvipddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvtpndfdfsvsnfv
dnlygypegkdtlretikfmytdwadkenpetrrktlvalftdhqwvapavatadlhaqy
gsptyfyafyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvmlsavv
mtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawsrynpkdqlylhiglkprvrdhyr
atkvafwlelvphl

Sequence, based on observed residues (ATOM records): (download)

>d3be8b1 c.69.1.0 (B:44-597) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgirnt
tqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvpteskkpvmv
yihggsymegtgnmidgsilasygnvivitinyrlgilgflstgdqaakgnyglldqiqa
lrwieenvgafggdpkrvtifgsgagascvslltlshyseglfqkaiiqsgtalsswavn
yqpakytriladkvgcnmldttdmveclrnknykeliqqtitpatyhiafgpvidgdvip
ddpqilmeqgeflnydimlgvnqgeglkfvdgivdnedgvtpndfdfsvsnfvdnlygyp
egkdtlretikfmytdwadkenpetrrktlvalftdhqwvapavatadlhaqygsptyfy
afyhhcqsemkpswadsahgdevpyvfgipmigptelfscnfskndvmlsavvmtywtnf
aktgdpnqpvevawsrynpkdqlylhiglkprvrdhyratkvafwlelvphl

SCOPe Domain Coordinates for d3be8b1:

Click to download the PDB-style file with coordinates for d3be8b1.
(The format of our PDB-style files is described here.)

Timeline for d3be8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3be8b2