Lineage for d3bb0a_ (3bb0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006139Family a.111.1.3: Chloroperoxidase [48325] (2 protein domains)
    duplication: contains two core bundles arranged as in the other family dimer
  6. 2006151Protein automated matches [254665] (1 species)
    not a true protein
  7. 2006152Species Curvularia inaequalis [TaxId:38902] [255761] (1 PDB entry)
  8. 2006153Domain d3bb0a_: 3bb0 A: [245366]
    automated match to d1vnca_
    complexed with po3, so4

Details for d3bb0a_

PDB Entry: 3bb0 (more details), 1.5 Å

PDB Description: crystal structure of a trapped phosphate-intermediate in vanadium apochloroperoxidase catalyzing a dephosphorylation reaction
PDB Compounds: (A:) vanadium chloroperoxidase

SCOPe Domain Sequences for d3bb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bb0a_ a.111.1.3 (A:) automated matches {Curvularia inaequalis [TaxId: 38902]}
vtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaihd
ayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpnp
npganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqeg
yhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehflad
ppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtpprf
ynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwrpls
gvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngrv
gtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawelm
fenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtred
reglfpiggvplgieiadeifnnglkptppeiqpmp

SCOPe Domain Coordinates for d3bb0a_:

Click to download the PDB-style file with coordinates for d3bb0a_.
(The format of our PDB-style files is described here.)

Timeline for d3bb0a_: