SCOPe 2.07: Domain d3ba0a2: 3ba0 A:275-470

Lineage for d3ba0a2 (3ba0 A:275-470)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.0: automated matches [196610] (1 protein)
   not a true family

6. Protein automated matches [196611] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [196612] (9 PDB entries)

8. Domain d3ba0a2: 3ba0 A:275-470 [245365]
   Other proteins in same PDB: d3ba0a1
   automated match to d1fbla1
   complexed with ca, hae, zn

Details for d3ba0a2

PDB Entry: 3ba0, 3 Å

PDB Description: crystal structure of full-length human mmp-12

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3ba0a2:

Sequence; same for both SEQRES and ATOM records:

>d3ba0a2 b.66.1.0 (A:275-470) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnsepalcdpnlsfdavttvgnkifffkdrffwlkvserpktsvnlisslwptlpsgiea
ayeiearnqvflfkddkywlisnlrpepnypksihsfgfpnfvkkidaavfnprfyrtyf
fvdnqywryderrqmmdpgypklitknfqgigpkidavfysknkyyyffqgsnqfeydfl
lqritktlksnswfgc

Timeline for d3ba0a2:

• d3ba0a2 first appeared in SCOPe 2.04
  
• d3ba0a2 appears in SCOPe 2.06
  
• d3ba0a2 appears in the current release, SCOPe 2.08