Lineage for d3ba0a1 (3ba0 A:106-274)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660634Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1660635Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1661136Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1661282Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 1661283Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 1661334Domain d3ba0a1: 3ba0 A:106-274 [245364]
    Other proteins in same PDB: d3ba0a2
    automated match to d1fbla2
    complexed with ca, hae, zn

Details for d3ba0a1

PDB Entry: 3ba0 (more details), 3 Å

PDB Description: crystal structure of full-length human mmp-12
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3ba0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ba0a1 d.92.1.11 (A:106-274) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygdpkenqrlpnp

SCOPe Domain Coordinates for d3ba0a1:

Click to download the PDB-style file with coordinates for d3ba0a1.
(The format of our PDB-style files is described here.)

Timeline for d3ba0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ba0a2