Lineage for d3b54a_ (3b54 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951431Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255759] (1 PDB entry)
  8. 2951432Domain d3b54a_: 3b54 A: [245360]
    automated match to d4o0na_
    complexed with po4

Details for d3b54a_

PDB Entry: 3b54 (more details), 3.1 Å

PDB Description: Saccharomyces cerevisiae nucleoside diphosphate kinase
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3b54a_:

Sequence, based on SEQRES records: (download)

>d3b54a_ d.58.6.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssqtertfiavkpdgvqrglvsqilsrfekkgyklvaiklvkaddklleqhyaehvgkpf
fpkmvsfmksgpilatvwegkdvvrqgrtilgatnplgsapgtirgdfgidlgrnvchgs
dsvdsaereinlwfkkeelvdwesnqakwiye

Sequence, based on observed residues (ATOM records): (download)

>d3b54a_ d.58.6.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssqtertfiavkpdgvqrglvsqilsrfekkgyklvaiklvkaddklleqhyafpkmvsf
mksgpilatvwegkdvvrqgrtilgatnplgsapgtirgdfgidlgrnvchgsdsvdsae
reinlwfkkeelvdwesnqakwiye

SCOPe Domain Coordinates for d3b54a_:

Click to download the PDB-style file with coordinates for d3b54a_.
(The format of our PDB-style files is described here.)

Timeline for d3b54a_: