SCOP 1.57: Domain d1azea_: 1aze A:

Lineage for d1azea_ (1aze A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (18 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1azea_: 1aze A: [24536]

Details for d1azea_

PDB Entry: 1aze

PDB Description: nmr structure of the complex between the c32s-y7v mutant of the nsh3 domain of grb2 with a peptide from sos, 10 structures

SCOP Domain Sequences for d1azea_:

Sequence; same for both SEQRES and ATOM records:

>d1azea_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
meaiakvdfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemk

Timeline for d1azea_:

• d1azea_ first appeared (with stable ids) in SCOP 1.55
  
• d1azea_ appears in SCOP 1.59
  
• d1azea_ appears in the current release, SCOPe 2.08