Lineage for d1azea_ (1aze A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783045Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2783055Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 2783062Domain d1azea_: 1aze A: [24536]
    N-terminal domain
    mutant

Details for d1azea_

PDB Entry: 1aze (more details)

PDB Description: nmr structure of the complex between the c32s-y7v mutant of the nsh3 domain of grb2 with a peptide from sos, 10 structures
PDB Compounds: (A:) grb2

SCOPe Domain Sequences for d1azea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azea_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakvdfkataddelsfkrgdilkvlneesdqnwykaelngkdgfipknyiemk

SCOPe Domain Coordinates for d1azea_:

Click to download the PDB-style file with coordinates for d1azea_.
(The format of our PDB-style files is described here.)

Timeline for d1azea_: