![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Sialic acid-binding protein SiaP [254345] (1 species) Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222 |
![]() | Species Haemophilus influenzae [TaxId:727] [254778] (7 PDB entries) |
![]() | Domain d3b50a1: 3b50 A:1-306 [245359] Other proteins in same PDB: d3b50a2 automated match to d2ceya_ complexed with slb has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3b50 (more details), 1.4 Å
SCOPe Domain Sequences for d3b50a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b50a1 c.94.1.1 (A:1-306) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]} adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq ieainp
Timeline for d3b50a1: