Lineage for d3b50a1 (3b50 A:1-306)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914644Protein Sialic acid-binding protein SiaP [254345] (1 species)
    Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222
  7. 2914645Species Haemophilus influenzae [TaxId:727] [254778] (7 PDB entries)
  8. 2914647Domain d3b50a1: 3b50 A:1-306 [245359]
    Other proteins in same PDB: d3b50a2
    automated match to d2ceya_
    complexed with slb

    has additional insertions and/or extensions that are not grouped together

Details for d3b50a1

PDB Entry: 3b50 (more details), 1.4 Å

PDB Description: structure of h. influenzae sialic acid binding protein bound to neu5ac.
PDB Compounds: (A:) Sialic acid-binding periplasmic protein siaP

SCOPe Domain Sequences for d3b50a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b50a1 c.94.1.1 (A:1-306) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp

SCOPe Domain Coordinates for d3b50a1:

Click to download the PDB-style file with coordinates for d3b50a1.
(The format of our PDB-style files is described here.)

Timeline for d3b50a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b50a2