Lineage for d3b1ta2 (3b1t A:113-293)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768533Superfamily b.2.9: Peptidylarginine deiminase Pad4, middle domain [110083] (2 families) (S)
    automatically mapped to Pfam PF08527
  5. 2768534Family b.2.9.1: Peptidylarginine deiminase Pad4, middle domain [110084] (1 protein)
  6. 2768535Protein Peptidylarginine deiminase Pad4, middle domain [110085] (1 species)
  7. 2768536Species Human (Homo sapiens) [TaxId:9606] [110086] (17 PDB entries)
    Uniprot Q9UM07
  8. 2768543Domain d3b1ta2: 3b1t A:113-293 [245354]
    Other proteins in same PDB: d3b1ta1, d3b1ta3
    automated match to d2dexx1
    complexed with ca, so4, ycl

Details for d3b1ta2

PDB Entry: 3b1t (more details), 2.5 Å

PDB Description: Crystal structure of human peptidylarginine deiminase 4 in complex with o-Cl-amidine
PDB Compounds: (A:) Protein-arginine deiminase type-4

SCOPe Domain Sequences for d3b1ta2:

Sequence, based on SEQRES records: (download)

>d3b1ta2 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkvkptravkdqrtwtwgpcgqgaillvncdrdnlessamdceddevl
dsedlqdmslmtlstktpkdfftnhtlvlhvarsemdkvrvfqatrgklsskcsvvlgpk
wpshylmvpggkhnmdfyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfr
v

Sequence, based on observed residues (ATOM records): (download)

>d3b1ta2 b.2.9.1 (A:113-293) Peptidylarginine deiminase Pad4, middle domain {Human (Homo sapiens) [TaxId: 9606]}
veislcaditrtgkqrtwtwgpcgqgaillvncdrdnlessamdceddevldsedlqdms
lmtlstktpkdfftnhtlvlhvarsemdkvrvfqatcsvvlgpkwpshylmvpggkhnmd
fyvealafpdtdfpglitltislldtsnlelpeavvfqdsvvfrv

SCOPe Domain Coordinates for d3b1ta2:

Click to download the PDB-style file with coordinates for d3b1ta2.
(The format of our PDB-style files is described here.)

Timeline for d3b1ta2: