Lineage for d3b13d_ (3b13 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867551Protein Rac [52595] (1 species)
  7. 2867552Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries)
  8. 2867584Domain d3b13d_: 3b13 D: [245352]
    automated match to d1ajea_
    mutant

Details for d3b13d_

PDB Entry: 3b13 (more details), 3.01 Å

PDB Description: Crystal structure of the DHR-2 domain of DOCK2 in complex with Rac1 (T17N mutant)
PDB Compounds: (D:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d3b13d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b13d_ c.37.1.8 (D:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgkncllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl

SCOPe Domain Coordinates for d3b13d_:

Click to download the PDB-style file with coordinates for d3b13d_.
(The format of our PDB-style files is described here.)

Timeline for d3b13d_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3b13b_