SCOPe 2.07: Domain d3b13b_: 3b13 B:

Lineage for d3b13b_ (3b13 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries)

8. Domain d3b13b_: 3b13 B: [245351]
   automated match to d1ajea_
   mutant

Details for d3b13b_

PDB Entry: 3b13, 3.01 Å

PDB Description: Crystal structure of the DHR-2 domain of DOCK2 in complex with Rac1 (T17N mutant)

PDB Compounds: (B:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d3b13b_:

Sequence; same for both SEQRES and ATOM records:

>d3b13b_ c.37.1.8 (B:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgkncllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavl

Timeline for d3b13b_:

• d3b13b_ first appeared in SCOPe 2.04
  
• d3b13b_ appears in SCOPe 2.06
  
• d3b13b_ appears in the current release, SCOPe 2.08