Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries) |
Domain d1io6a_: 1io6 A: [24535] C-terminal domain |
PDB Entry: 1io6 (more details)
SCOPe Domain Sequences for d1io6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io6a_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr
Timeline for d1io6a_: