SCOP 1.73: Domain d1io6a_: 1io6 A:

Lineage for d1io6a_ (1io6 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (38 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1io6a_: 1io6 A: [24535]
   C-terminal domain

Details for d1io6a_

PDB Entry: 1io6

PDB Description: growth factor receptor-bound protein 2 (grb2) c-terminal sh3 domain complexed with a ligand peptide (nmr, minimized mean structure)

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d1io6a_:

Sequence; same for both SEQRES and ATOM records:

>d1io6a_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

Timeline for d1io6a_:

• d1io6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1io6a_ appears in SCOP 1.71
  
• d1io6a_ appears in SCOP 1.75
  
• d1io6a_ appears in the current release, SCOPe 2.08, called d1io6a1