Lineage for d1io6a1 (1io6 A:3-59)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783045Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2783055Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 2783065Domain d1io6a1: 1io6 A:3-59 [24535]
    Other proteins in same PDB: d1io6a2
    C-terminal domain

Details for d1io6a1

PDB Entry: 1io6 (more details)

PDB Description: growth factor receptor-bound protein 2 (grb2) c-terminal sh3 domain complexed with a ligand peptide (nmr, minimized mean structure)
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d1io6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1io6a1 b.34.2.1 (A:3-59) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

SCOPe Domain Coordinates for d1io6a1:

Click to download the PDB-style file with coordinates for d1io6a1.
(The format of our PDB-style files is described here.)

Timeline for d1io6a1: