| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) ![]() duplication: contains two subdomains of this fold |
| Family d.58.36.0: automated matches [254283] (1 protein) not a true family |
| Protein automated matches [254662] (3 species) not a true protein |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255757] (16 PDB entries) |
| Domain d3b0ma1: 3b0m A:18-174 [245343] Other proteins in same PDB: d3b0ma2, d3b0ma4 automated match to d2akja2 complexed with cl, k, sf4, srm; mutant |
PDB Entry: 3b0m (more details), 1.9 Å
SCOPe Domain Sequences for d3b0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b0ma1 d.58.36.0 (A:18-174) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
vaaerleprveekdgywilkeqfrkginpqekvkiekepmklfmengieelakipieeid
qskltkddidvrlkwlglfhrrknqygrfmmrlklpngvttsaqtrylasvirkygkegc
adittrqnwqirgvvlpdvpeilkglaevgltslqsg
Timeline for d3b0ma1: