| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
| Family d.134.1.0: automated matches [254284] (1 protein) not a true family |
| Protein automated matches [254663] (3 species) not a true protein |
| Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255758] (16 PDB entries) |
| Domain d3b0la2: 3b0l A:175-345 [245340] Other proteins in same PDB: d3b0la1, d3b0la3 automated match to d2akja4 complexed with cl, k, sf4, srm; mutant |
PDB Entry: 3b0l (more details), 1.7 Å
SCOPe Domain Sequences for d3b0la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b0la2 d.134.1.0 (A:175-345) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
gdnvrnpvgnplagidpeeivdtrpytnllsqfitgnsrgnpavsnlprkwnpcvvgshd
lyehphindlaympatkdgrfgfnllvggffsakrcdeaipldawvpaddvvpvcraile
afrdlgfrgnrqkcrmmwlidelgvegfraevekrmpqqqleraspedlvq
Timeline for d3b0la2: