Lineage for d1grib2 (1gri B:157-217)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310182Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 1310192Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 1310198Domain d1grib2: 1gri B:157-217 [24534]
    Other proteins in same PDB: d1gria3, d1grib3

Details for d1grib2

PDB Entry: 1gri (more details), 3.1 Å

PDB Description: grb2
PDB Compounds: (B:) growth factor bound protein 2

SCOPe Domain Sequences for d1grib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1grib2 b.34.2.1 (B:157-217) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
qptyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnrn
v

SCOPe Domain Coordinates for d1grib2:

Click to download the PDB-style file with coordinates for d1grib2.
(The format of our PDB-style files is described here.)

Timeline for d1grib2: