Lineage for d3b0hb3 (3b0h B:346-430)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955515Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 2955516Protein automated matches [254662] (3 species)
    not a true protein
  7. 2955533Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255757] (16 PDB entries)
  8. 2955567Domain d3b0hb3: 3b0h B:346-430 [245333]
    Other proteins in same PDB: d3b0ha2, d3b0ha4, d3b0hb2, d3b0hb4
    automated match to d2akja1
    complexed with cl, k, sf4, srm

Details for d3b0hb3

PDB Entry: 3b0h (more details), 2.31 Å

PDB Description: assimilatory nitrite reductase (nii4) from tobbaco root
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d3b0hb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b0hb3 d.58.36.0 (B:346-430) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
kqwerreylgvhpqkqegysfvglhipvgrvqaddmdelarladeygsgelrltveqnii
ipnvknskieallnepllknrfstd

SCOPe Domain Coordinates for d3b0hb3:

Click to download the PDB-style file with coordinates for d3b0hb3.
(The format of our PDB-style files is described here.)

Timeline for d3b0hb3: