SCOP 1.73: Domain d1grib1: 1gri B:1-56

Lineage for d1grib1 (1gri B:1-56)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (38 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1grib1: 1gri B:1-56 [24533]
   Other proteins in same PDB: d1gria3, d1grib3

Details for d1grib1

PDB Entry: 1gri, 3.1 Å

PDB Description: grb2

PDB Compounds: (B:) growth factor bound protein 2

SCOP Domain Sequences for d1grib1:

Sequence, based on SEQRES records:

>d1grib1 b.34.2.1 (B:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk

Sequence, based on observed residues (ATOM records):

>d1grib1 b.34.2.1 (B:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk

Timeline for d1grib1:

• d1grib1 first appeared (with stable ids) in SCOP 1.55
  
• d1grib1 appears in SCOP 1.71
  
• d1grib1 appears in SCOP 1.75
  
• d1grib1 appears in the current release, SCOPe 2.08