Lineage for d1grib1 (1gri B:1-56)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665245Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 665255Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 665260Domain d1grib1: 1gri B:1-56 [24533]
    Other proteins in same PDB: d1gria3, d1grib3

Details for d1grib1

PDB Entry: 1gri (more details), 3.1 Å

PDB Description: grb2
PDB Compounds: (B:) growth factor bound protein 2

SCOP Domain Sequences for d1grib1:

Sequence, based on SEQRES records: (download)

>d1grib1 b.34.2.1 (B:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk

Sequence, based on observed residues (ATOM records): (download)

>d1grib1 b.34.2.1 (B:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk

SCOP Domain Coordinates for d1grib1:

Click to download the PDB-style file with coordinates for d1grib1.
(The format of our PDB-style files is described here.)

Timeline for d1grib1: