Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries) |
Domain d1grib1: 1gri B:1-56 [24533] Other proteins in same PDB: d1gria3, d1grib3 |
PDB Entry: 1gri (more details), 3.1 Å
SCOPe Domain Sequences for d1grib1:
Sequence, based on SEQRES records: (download)
>d1grib1 b.34.2.1 (B:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk
>d1grib1 b.34.2.1 (B:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk
Timeline for d1grib1: