Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) duplication: contains two domains of this fold |
Family d.134.1.0: automated matches [254284] (1 protein) not a true family |
Protein automated matches [254663] (3 species) not a true protein |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255758] (16 PDB entries) |
Domain d3b0ga4: 3b0g A:430-555 [245326] Other proteins in same PDB: d3b0ga1, d3b0ga3 automated match to d2akja3 complexed with cl, k, sf4, srm |
PDB Entry: 3b0g (more details), 1.25 Å
SCOPe Domain Sequences for d3b0ga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b0ga4 d.134.1.0 (A:430-555) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} ppilmkglvactgnqfcgqaiietkarslkiteevqrqvsltkpvrmhwtgcpntcaqvq vadigfmgcltrdkngktvegadvflggrigsdshlgevykkavpcddlvplvvdllvnn fgavpr
Timeline for d3b0ga4: