SCOPe 2.02: Domain d1gria2: 1gri A:157-217

Lineage for d1gria2 (1gri A:157-217)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gria2: 1gri A:157-217 [24532]
   Other proteins in same PDB: d1gria3, d1grib3

Details for d1gria2

PDB Entry: 1gri, 3.1 Å

PDB Description: grb2

PDB Compounds: (A:) growth factor bound protein 2

SCOPe Domain Sequences for d1gria2:

Sequence; same for both SEQRES and ATOM records:

>d1gria2 b.34.2.1 (A:157-217) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
qptyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnrn
v

Timeline for d1gria2:

• d1gria2 first appeared (with stable ids) in SCOP 1.55
  
• d1gria2 appears in SCOPe 2.01
  
• d1gria2 appears in SCOPe 2.03
  
• d1gria2 appears in the current release, SCOPe 2.08