Lineage for d1gria2 (1gri A:157-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2045952Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 2045962Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 2045966Domain d1gria2: 1gri A:157-217 [24532]
    Other proteins in same PDB: d1gria3, d1grib3

Details for d1gria2

PDB Entry: 1gri (more details), 3.1 Å

PDB Description: grb2
PDB Compounds: (A:) growth factor bound protein 2

SCOPe Domain Sequences for d1gria2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gria2 b.34.2.1 (A:157-217) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
qptyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnrn
v

SCOPe Domain Coordinates for d1gria2:

Click to download the PDB-style file with coordinates for d1gria2.
(The format of our PDB-style files is described here.)

Timeline for d1gria2: