Lineage for d1gria1 (1gri A:1-56)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796299Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 796309Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)
  8. 796312Domain d1gria1: 1gri A:1-56 [24531]
    Other proteins in same PDB: d1gria3, d1grib3

Details for d1gria1

PDB Entry: 1gri (more details), 3.1 Å

PDB Description: grb2
PDB Compounds: (A:) growth factor bound protein 2

SCOP Domain Sequences for d1gria1:

Sequence, based on SEQRES records: (download)

>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk

Sequence, based on observed residues (ATOM records): (download)

>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk

SCOP Domain Coordinates for d1gria1:

Click to download the PDB-style file with coordinates for d1gria1.
(The format of our PDB-style files is described here.)

Timeline for d1gria1: