| Class b: All beta proteins [48724] (165 folds) |
| Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
| Family b.34.2.1: SH3-domain [50045] (38 proteins) |
| Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries) |
| Domain d1gria1: 1gri A:1-56 [24531] Other proteins in same PDB: d1gria3, d1grib3 |
PDB Entry: 1gri (more details), 3.1 Å
SCOP Domain Sequences for d1gria1:
Sequence, based on SEQRES records: (download)
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk
Timeline for d1gria1: