SCOP 1.71: Domain d1gria1: 1gri A:1-56

Lineage for d1gria1 (1gri A:1-56)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (37 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries)

8. Domain d1gria1: 1gri A:1-56 [24531]
   Other proteins in same PDB: d1gria3, d1grib3

Details for d1gria1

PDB Entry: 1gri, 3.1 Å

PDB Description: grb2

SCOP Domain Sequences for d1gria1:

Sequence, based on SEQRES records:

>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk

Sequence, based on observed residues (ATOM records):

>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk

Timeline for d1gria1:

• d1gria1 first appeared (with stable ids) in SCOP 1.55
  
• d1gria1 appears in SCOP 1.69
  
• d1gria1 appears in SCOP 1.73
  
• d1gria1 appears in the current release, SCOPe 2.08