![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries) |
![]() | Domain d1gria1: 1gri A:1-56 [24531] Other proteins in same PDB: d1gria3, d1grib3 |
PDB Entry: 1gri (more details), 3.1 Å
SCOPe Domain Sequences for d1gria1:
Sequence, based on SEQRES records: (download)
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemk
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} meaiakydfkataddelsfkrgdilkvqnwykaelngkdgfipknyiemk
Timeline for d1gria1: