Lineage for d1qlya_ (1qly A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58293Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 58294Family b.34.2.1: SH3-domain [50045] (18 proteins)
  6. 58324Protein Bruton's tyrosine kinase [50068] (1 species)
  7. 58325Species Human (Homo sapiens) [TaxId:9606] [50069] (3 PDB entries)
  8. 58328Domain d1qlya_: 1qly A: [24530]

Details for d1qlya_

PDB Entry: 1qly (more details)

PDB Description: nmr study of the sh3 domain from bruton's tyrosine kinase, 20 structures

SCOP Domain Sequences for d1qlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlya_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens)}
lkkvvalydympmnandlqlrkgdeyfileesnlpwwrardkngqegyipsnyvteae

SCOP Domain Coordinates for d1qlya_:

Click to download the PDB-style file with coordinates for d1qlya_.
(The format of our PDB-style files is described here.)

Timeline for d1qlya_: